DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nr2c1

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001018458.1 Gene:nr2c1 / 553649 ZFINID:ZDB-GENE-041210-198 Length:600 Species:Danio rerio


Alignment Length:101 Identity:47/101 - (46%)
Similarity:60/101 - (59%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||::||:|||...|:||..|||||:|:...|.|.. .|.||::|..||.|..||.|||:|:
Zfish   113 CVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLVYTCRG-SGECVINKHHRNRCQYCRLQRCMAL 176

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPS 107
            ||...:||.||.|    |.:.|     ..|:..|||
Zfish   177 GMKQDSVQCERKP----VEVSR-----EKPANCAPS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 41/80 (51%)
nr2c1NP_001018458.1 NR_DBD_TR2_like 108..194 CDD:143525 42/85 (49%)
NR_LBD_TR2_like 365..586 CDD:132750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.