DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and PPARA

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001001928.1 Gene:PPARA / 5465 HGNCID:9232 Length:468 Species:Homo sapiens


Alignment Length:380 Identity:81/380 - (21%)
Similarity:146/380 - (38%) Gaps:126/380 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALV-----GNCVVDKARRNWCPSCRFQ 66
            |.:|||::||.||||..|:||..||:|::|       :.||     .:|.:.|..||.|..|||.
Human   102 CRICGDKASGYHYGVHACEGCKGFFRRTIR-------LKLVYDKCDRSCKIQKKNRNKCQYCRFH 159

  Fly    67 RCLAVGMNAAAVQEERGPRNQQVAL---YRTGRRQAPPSQAAPSPTPHSQALHF--------QIL 120
            :||:|||:..|::..|.||:::..|   ..|.......|:.|...:...:....        ::.
Human   160 KCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVK 224

  Fly   121 AQILVT-----------------CLRQ-------------------------------------- 130
            |:::::                 |:.:                                      
Human   225 ARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTE 289

  Fly   131 -AKANEQFALLDRCQQDAIFQV-VWSEIFVLRASHWSLDISAMIDGCGD--------EQLKRLIC 185
             |||...||.||...|..:.:. |:..||.:.:|..:.|  .|:...|:        :.|::..|
Human   290 FAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKD--GMLVAYGNGFITREFLKSLRKPFC 352

  Fly   186 EAHQ------LRADVLELN------FMESLILC--RKELAINAEYAVILGSHSKAALISLARYTL 236
            :..:      ::.:.|||:      |:.::|.|  |..| :|..:.    ...:..::.:.|..|
Human   353 DIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGL-LNVGHI----EKMQEGIVHVLRLHL 412

  Fly   237 QQSN------YLRFGQLLLGLRQLCLR-----------RFDCALSCMFRSVVRDI 274
            |.::      :.:..|.:..||||...           ..|.||..:.:.:.||:
Human   413 QSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDM 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 36/85 (42%)
PPARANP_001001928.1 NR_DBD_Ppar 101..184 CDD:143523 36/88 (41%)
NR_LBD_PPAR 201..467 CDD:132730 41/272 (15%)
Required for heterodimerization with RXRA 304..433 23/135 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.