DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and tll

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster


Alignment Length:407 Identity:110/407 - (27%)
Similarity:149/407 - (36%) Gaps:142/407 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIA-LVGNCVVDKARRNWCPSCRFQRCLA 70
            |.||.|.|||||||:..||||:.|||||:||...|.|.: ..|.|||||..||.|.:||.::|..
  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98

  Fly    71 VGMNAAAVQEERGPRN----QQVALY--------------------------------------- 92
            ||||..|||.||||||    :.:|:|                                       
  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163

  Fly    93 RTGRR-------QAPPSQAAP---------------------SPT----------------PHSQ 113
            |.|..       |.|||.||.                     |||                |...
  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228

  Fly   114 ALHF-QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDIS-AMI---- 172
            |.|. :..|:.|...:...|:...|..|....|..:.:..|.|.|:|..:.:.:.:: |.:    
  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVY 293

  Fly   173 --DGCGDEQLKRLICEAH----------QLRADVLELNFMESLILCRK---------ELA----- 211
              :....|.:..:..|.|          .|..|..|...:.::.|.||         :||     
  Fly   294 ESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSIL 358

  Fly   212 ---------INAEYAVILGSHSKAALISLARYTLQQSNY---------LRFGQLLLGLRQLCLRR 258
                     .:||...:|.|...||:.:.||..|.  ||         :|| |.|||:.||..:.
  Fly   359 TGSGSPNSSASAESRGLLESGKVAAMHNDARSALH--NYIQRTHPSQPMRF-QTLLGVVQLMHKV 420

  Fly   259 FDCAL-SCMFRSVVRDI 274
            ....: ...||..:.||
  Fly   421 SSFTIEELFFRKTIGDI 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 49/85 (58%)
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 49/82 (60%)
NR_LBD 215..436 CDD:416257 46/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.