DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nr2f6b

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_021335261.1 Gene:nr2f6b / 406522 ZFINID:ZDB-GENE-040426-2351 Length:409 Species:Danio rerio


Alignment Length:330 Identity:85/330 - (25%)
Similarity:133/330 - (40%) Gaps:99/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:||||||||..|:||..|||||:||..:|.|.: ...|.:|:..||.|..||.::|..|
Zfish    53 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLNYTCRS-NRECQIDQHHRNQCQYCRLKKCFRV 116

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPT--------------------------- 109
            ||.         ...||....:.||  .|||.|..||.                           
Zfish   117 GMR---------KEGQQTPTVQRGR--IPPSHAGISPASMVGAGGDVGGGPGMGADFFNGQPVSE 170

  Fly   110 -----------PHS-------QALH------------FQILAQILVTCLRQAKANEQFALLDRCQ 144
                       |:|       |.|.            .::.|::|.:.:..|:....|..|...:
Zfish   171 LISQLLRAEPYPNSRYGAQCGQQLQGANSSMMGIDNICELAARLLFSTIEWARNIPYFPDLPVSE 235

  Fly   145 QDAIFQVVWSEIFVLRASHWSLDI--SAMIDGCG---------------------DEQLKRLICE 186
            |.|:.::.|||:|:|.|:..:|.:  :.::...|                     .:|:.:|.  
Zfish   236 QVALLRLSWSELFILNAAQSALPLHTAPLLAAAGFHSSPMPADRVVSFMDQVRVFQDQVDKLT-- 298

  Fly   187 AHQLRADVLELNFMESLILCRKELAINAEYAVILGSHSKAALISLARYTLQQ--SNYLRFGQLLL 249
              :|:.|.:|.:.::::.|...:....::.|.:.....||. ::|..|...|  ....|||:|||
Zfish   299 --RLQVDSVEYSCLKAIALFSPDACGLSDPAHVESLQEKAQ-VALTEYERMQYPGQPQRFGRLLL 360

  Fly   250 GLRQL 254
            .|..|
Zfish   361 RLPAL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 36/80 (45%)
nr2f6bXP_021335261.1 NR_DBD_COUP_TF 53..124 CDD:143516 36/80 (45%)
NR_LBD_COUP-TF 167..408 CDD:132746 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.