DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Hr78

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001189151.1 Gene:Hr78 / 40378 FlyBaseID:FBgn0015239 Length:601 Species:Drosophila melanogaster


Alignment Length:172 Identity:56/172 - (32%)
Similarity:80/172 - (46%) Gaps:43/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||::||:|||...|:||..|||||:|:...|.|...: ||.|.|..||.|..||.|:|||.
  Fly    52 CLVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGAM-NCEVTKHHRNRCQFCRLQKCLAS 115

  Fly    72 GMNAAAVQEERGP---RNQQVAL-----------------------YRTGRRQ--APPSQAAPSP 108
            ||.:.:||.||.|   |.:.:..                       |:.||.:  :..:::|.:|
  Fly   116 GMRSDSVQHERKPIVDRKEGIIAAAGSSSTSGGGNGSSTYLSGKSGYQQGRGKGHSVKAESAATP 180

  Fly   109 TPHS--------------QALHFQILAQILVTCLRQAKANEQ 136
            ..||              ..|:|..|.|.|:...:|.:..:|
  Fly   181 PVHSAPATAFNLNENIFPMGLNFAELTQTLMFATQQQQQQQQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/83 (51%)
Hr78NP_001189151.1 NR_DBD_TR2_like 47..133 CDD:143525 41/81 (51%)
NR_LBD_TR2_like 372..595 CDD:132750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.