DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nr2f1b

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_956886.1 Gene:nr2f1b / 393564 ZFINID:ZDB-GENE-040426-1438 Length:389 Species:Danio rerio


Alignment Length:298 Identity:93/298 - (31%)
Similarity:136/298 - (45%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:|||||||...|:||..||||||||..||.|.| ..||.||:..||.|..||.::||.|
Zfish    54 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRA-NRNCPVDQHHRNQCQYCRLKKCLKV 117

  Fly    72 GMNAAAVQEERGPRNQ----QVAL----------YRTG----RRQAPPSQAAPSPTPHSQALHF- 117
            ||...|||..|.|.||    ..||          |.:|    ..:|.|..|:.......|:.:. 
Zfish   118 GMRREAVQRGRMPPNQPNPSHYALTNGDHLNGQCYLSGYISLLLRAEPYPASRYGNQCMQSGNIM 182

  Fly   118 ------QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--LDISAMIDG 174
                  ::.|::|.:.:..|:....|..|....|.::.::.|||:|||.|:..|  |.::.::..
Zfish   183 GIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQSSMPLHVAPLLAA 247

  Fly   175 CG---------------------DEQLKRLICEAHQLRADVLELNFMESLILCRKELAINAEYAV 218
            .|                     .||:::|    ..|:.|..|.:..::::|...:....::...
Zfish   248 AGLHASPMSADRVVAFMDHIRFFQEQVEKL----KALQVDSAEYSCAKAIVLFTSDACGLSDIPH 308

  Fly   219 ILGSHSKAALISLARYTLQQ--SNYLRFGQLLLGLRQL 254
            |.|...|:. .:|..|...|  :...|||:|||.|..|
Zfish   309 IEGLQEKSQ-CALEEYVRSQYPNQPTRFGKLLLRLPAL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 48/84 (57%)
nr2f1bNP_956886.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..39
NR_DBD_COUP_TF 54..126 CDD:143516 43/72 (60%)
NR_LBD_COUP-TF 152..387 CDD:132746 43/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.