DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Hnf4g

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006232227.1 Gene:Hnf4g / 365744 RGDID:1310102 Length:462 Species:Rattus norvegicus


Alignment Length:293 Identity:86/293 - (29%)
Similarity:132/293 - (45%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||:|||:::|||||.|.||||..||:||:|:...|:| .....|||||.:||.|..||.::|...
  Rat    66 CAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSC-RFSRQCVVDKDKRNQCRYCRLRKCFRA 129

  Fly    72 GMNAAAVQEERGPRNQQVALYR---------TGRRQAPPSQ-AAPSPTPHSQALHFQILAQILVT 126
            ||...|||.||...:.:.:.|.         ..:.:....| :.|:|:. |..::.:.:|.|...
  Rat   130 GMKKEAVQNERDRISTRRSTYEGTNIPSINTLAQAEVRSCQISVPNPSA-STDINVKKIASISDV 193

  Fly   127 C--LRQ--------AKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSL---DISAMIDGCGDE 178
            |  ::|        ||....|..|....|.|:.:....|..:|.|:..|:   ||..:    |:.
  Rat   194 CESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLL----GNH 254

  Fly   179 Q-LKRLICEAHQLRADVLELNFMESLILCRKELAI-NAEYAVILG---------SHSKAALISLA 232
            . :.|..||....|   :....::.|:...:|:.| :.|||.:..         ..|....|...
  Rat   255 YVIHRNSCEVEVSR---VANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPGKIKNM 316

  Fly   233 RYTLQQS--NYL---------RFGQLLLGLRQL 254
            |:.:|.|  :|:         |||:|||.|..|
  Rat   317 RFQVQISLEDYINDRQYDSRGRFGELLLLLPTL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 40/80 (50%)
Hnf4gXP_006232227.1 NR_DBD_HNF4A 66..141 CDD:143518 39/75 (52%)
NR_LBD_HNF4_like 157..378 CDD:132729 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.