DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and dsf

DIOPT Version :10

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_477140.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster


Alignment Length:115 Identity:55/115 - (47%)
Similarity:65/115 - (56%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIA---LVGNCVVDKARRNWCPSCRFQRC 68
            |.||||:|||||||:..|||||.|||||:.|...|.|.|   |.|.|.|||..||.|.:||..:|
  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77

  Fly    69 LAVGMNAAAVQEERGPRNQQV--ALYRTGRRQAPPSQAAPSPTPHSQALH 116
            ....||..|||.|||||..::  .|:......|    ||.:...|:.|.|
  Fly    78 FQSAMNKDAVQHERGPRKPKLHPQLHHHHHHAA----AAAAAAHHAAAAH 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 48/83 (58%)
dsfNP_477140.1 NR_DBD_TLX 5..98 CDD:143537 48/84 (57%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.