DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and HNF4A

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_005260464.1 Gene:HNF4A / 3172 HGNCID:5024 Length:513 Species:Homo sapiens


Alignment Length:310 Identity:88/310 - (28%)
Similarity:134/310 - (43%) Gaps:87/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||:|||:::|||||.|.||||..||:||||:...|:| .....|||||.:||.|..||.::|...
Human    99 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSC-RFSRQCVVDKDKRNQCRYCRLKKCFRA 162

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPTPHSQALHFQILAQILVTCLR----QAK 132
            ||...|||.||    .:::.    ||.:....:.||.....||   ::|::.:.:.:.    ..:
Human   163 GMKKEAVQNER----DRIST----RRSSYEDSSLPSINALLQA---EVLSRQITSPVSGINGDIR 216

  Fly   133 ANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGCGDEQLKRLICEA--HQLRA--- 192
            |.:..::.|.|:.      :..::.||  ..|:..|.|..:...|:|:..|...|  |.|..   
Human   217 AKKIASIADVCES------MKEQLLVL--VEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATK 273

  Fly   193 ------DVL---------------------ELNFMESLILCRKELAI-NAEYAVILGSHSKAAL- 228
                  |||                     .:..::.|:|..:||.| :.|||.:     ||.: 
Human   274 RSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYL-----KAIIF 333

  Fly   229 -------------ISLARYTLQQS--NYL---------RFGQLLLGLRQL 254
                         |...|..:|.|  :|:         |||:|||.|..|
Human   334 FDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 41/80 (51%)
HNF4AXP_005260464.1 NR_DBD_HNF4A 99..174 CDD:143518 41/79 (52%)
NR_LBD_HNF4_like 190..412 CDD:132729 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.