Sequence 1: | NP_649647.1 | Gene: | Hr83 / 40783 | FlyBaseID: | FBgn0037436 | Length: | 278 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005260464.1 | Gene: | HNF4A / 3172 | HGNCID: | 5024 | Length: | 513 | Species: | Homo sapiens |
Alignment Length: | 310 | Identity: | 88/310 - (28%) |
---|---|---|---|
Similarity: | 134/310 - (43%) | Gaps: | 87/310 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
Fly 72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPTPHSQALHFQILAQILVTCLR----QAK 132
Fly 133 ANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGCGDEQLKRLICEA--HQLRA--- 192
Fly 193 ------DVL---------------------ELNFMESLILCRKELAI-NAEYAVILGSHSKAAL- 228
Fly 229 -------------ISLARYTLQQS--NYL---------RFGQLLLGLRQL 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hr83 | NP_649647.1 | NR_DBD_PNR_like_2 | 7..88 | CDD:143515 | 41/80 (51%) |
HNF4A | XP_005260464.1 | NR_DBD_HNF4A | 99..174 | CDD:143518 | 41/79 (52%) |
NR_LBD_HNF4_like | 190..412 | CDD:132729 | 44/210 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144381 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |