DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Nr2c1

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_665723.1 Gene:Nr2c1 / 252924 RGDID:3200 Length:590 Species:Rattus norvegicus


Alignment Length:81 Identity:40/81 - (49%)
Similarity:53/81 - (65%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRC 68
            |..|.||||::||:|||...|:||..|||||:|:...|:|.. ..:|:::|..||.|..||.|||
  Rat    98 FDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRG-SKDCIINKHHRNRCQYCRLQRC 161

  Fly    69 LAVGMNAAAVQEERGP 84
            :|.||...:||.||.|
  Rat   162 IAFGMKQDSVQCERKP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 39/78 (50%)
Nr2c1NP_665723.1 Required for interaction with KAT2B. /evidence=ECO:0000250 1..166 33/68 (49%)
NR_DBD_TR2_like 96..182 CDD:143525 40/81 (49%)
NR_LBD_TR2_like 355..576 CDD:132750
Required for interaction with NRIP1. /evidence=ECO:0000250 571..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.