DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Nr2c1

DIOPT Version :10

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_665723.1 Gene:Nr2c1 / 252924 RGDID:3200 Length:590 Species:Rattus norvegicus


Alignment Length:81 Identity:40/81 - (49%)
Similarity:53/81 - (65%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRC 68
            |..|.||||::||:|||...|:||..|||||:|:...|:|.. ..:|:::|..||.|..||.|||
  Rat    98 FDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRG-SKDCIINKHHRNRCQYCRLQRC 161

  Fly    69 LAVGMNAAAVQEERGP 84
            :|.||...:||.||.|
  Rat   162 IAFGMKQDSVQCERKP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 39/78 (50%)
Nr2c1NP_665723.1 Required for interaction with KAT2B. /evidence=ECO:0000250 1..166 33/68 (49%)
NR_DBD_TR2_like 96..182 CDD:143525 40/81 (49%)
NR_LBD_TR2_like 355..576 CDD:132750
Required for interaction with NRIP1. /evidence=ECO:0000250 571..590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.