DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Rxra

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_038960270.1 Gene:Rxra / 25271 RGDID:3610 Length:507 Species:Rattus norvegicus


Alignment Length:325 Identity:95/325 - (29%)
Similarity:143/325 - (44%) Gaps:59/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFS--ACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSC 63
            ||:|:  .||:|||:||||||||..|:||..||||:||:..:|.| ....:|::||.:||.|..|
  Rat   172 MSSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTC-RDNKDCLIDKRQRNRCQYC 235

  Fly    64 RFQRCLAVGMNAAAVQEER---GPRNQQVALYRTGRRQAPP------SQAAPSP----------- 108
            |:|:|||:||...||||||   ..||:......:...:..|      ::.|..|           
  Rat   236 RYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMG 300

  Fly   109 ----TPHSQALHF-QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDI 168
                :|:....:. |...:.|.|.:..||....|:.|....|..:.:..|:|:.:...||.|:.:
  Rat   301 LNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV 365

  Fly   169 ---------------SAMIDGCG---DEQLKRLICEAHQLRADVLELNFMESLILCR---KELAI 212
                           ||...|.|   |..|..|:.:...::.|..||..:.:::|..   |.|:.
  Rat   366 KDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSN 430

  Fly   213 NAEYAVILGSHSKAALISLARYTL----QQSNYLRFGQLLLGLRQLCLRRFDCALSCMFRSVVRD 273
            .||...:    .:....||..|..    :|..  ||.:|||.|..|......|.....|..::.|
  Rat   431 PAEVEAL----REKVYASLEAYCKHKYPEQPG--RFAKLLLRLPALRSIGLKCLEHLFFFKLIGD 489

  Fly   274  273
              Rat   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 46/83 (55%)
RxraXP_038960270.1 Nuc_recep-AF1 58..171 CDD:403126
NR_DBD_RXR 178..254 CDD:143514 42/76 (55%)
NR_LBD_RXR_like 274..485 CDD:132741 45/216 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.