DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and NR2F6

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_005225.2 Gene:NR2F6 / 2063 HGNCID:7977 Length:404 Species:Homo sapiens


Alignment Length:355 Identity:95/355 - (26%)
Similarity:145/355 - (40%) Gaps:106/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:||||||||..|:||..|||||:||..||.|.: ..:|.:|:..||.|..||.::|..|
Human    56 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRS-NRDCQIDQHHRNQCQYCRLKKCFRV 119

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPTPHSQAL--------------------- 115
            ||...|||..|.|.:            .|.:.||.|.:|...||                     
Human   120 GMRKEAVQRGRIPHS------------LPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQ 172

  Fly   116 ------------HF-----------------QILAQILVTCLRQAKANEQFALLDRCQQDAIFQV 151
                        .|                 ::.|::|.:.:..|:....|..|....|.|:.::
Human   173 LLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRL 237

  Fly   152 VWSEIFVLRASHWSLDI--SAMIDGCG---------------------DEQLKRLICEAHQLRAD 193
            .|||:|||.|:..:|.:  :.::...|                     .||:.:|    .:|:.|
Human   238 SWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKL----GRLQVD 298

  Fly   194 VLELNFMESLILCRKELAINAEYAVILGSHSKAALISLARYTLQQ--SNYLRFGQLLLGLRQLCL 256
            ..|...::::.|...:....::.|.:.....||. ::|..|...|  |...|||:||  ||...|
Human   299 SAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQ-VALTEYVRAQYPSQPQRFGRLL--LRLPAL 360

  Fly   257 RRFDCAL-SCMF----------RSVVRDIL 275
            |....:| |.:|          .:::||:|
Human   361 RAVPASLISQLFFMRLVGKTPIETLIRDML 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/80 (53%)
NR2F6NP_005225.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
NR_DBD_COUP_TF 56..128 CDD:143516 39/72 (54%)
NR_LBD_COUP-TF 165..400 CDD:132746 46/233 (20%)
Important for dimerization. /evidence=ECO:0000250 327..404 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.