DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Rxrg

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_033133.1 Gene:Rxrg / 20183 MGIID:98216 Length:463 Species:Mus musculus


Alignment Length:318 Identity:87/318 - (27%)
Similarity:137/318 - (43%) Gaps:62/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||:|||:||||||||..|:||..||||::|:...|.| ....:|::||.:||.|..||:|:||.:
Mouse   139 CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTC-RDNKDCLIDKRQRNRCQYCRYQKCLVM 202

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPTPHSQALHFQILAQ-------------- 122
            ||...|||||| .|:::.|     ..:|..:.::....|..:.|..::..:              
Mouse   203 GMKREAVQEER-QRSRERA-----ESEAECASSSHEDMPVERILEAELAVEPKTESYGDMNVENS 261

  Fly   123 --------------ILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDI----- 168
                          .|.|.:..||....|:.|....|..:.:..|:|:.:...||.|:.:     
Mouse   262 TNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGIL 326

  Fly   169 ----------SAMIDGCG---DEQLKRLICEAHQLRADVLELNFMESLILCR---KELAINAEYA 217
                      ||...|.|   |..|..|:.:...::.|..||..:.:::|..   |.|:..:|..
Mouse   327 LATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVE 391

  Fly   218 VILGSHSKAALISLARYTLQQ--SNYLRFGQLLLGLRQLCLRRFDCALSCMFRSVVRD 273
            .:    .:....:|..||.|:  ....||.:|||.|..|......|.....|..::.|
Mouse   392 TL----REKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 43/80 (54%)
RxrgNP_033133.1 Modulating. /evidence=ECO:0000250 1..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..53
Nuc_recep-AF1 25..133 CDD:288658
NR_DBD_RXR 137..213 CDD:143514 40/74 (54%)
Hinge 205..230 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..232 6/26 (23%)
NR_LBD_RXR_like 233..441 CDD:132741 41/211 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.