DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-236

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_500190.3 Gene:nhr-236 / 189677 WormBaseID:WBGene00021417 Length:283 Species:Caenorhabditis elegans


Alignment Length:268 Identity:85/268 - (31%)
Similarity:119/268 - (44%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||::||:||||..||||..|||||:||...|:| ...|:||:|..|||.|.:||||:|:.|
 Worm    13 CRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYSC-KESGDCVIDVTRRNQCQACRFQKCITV 76

  Fly    72 GMNAAAVQEER-----GPRNQQVALYRTGRRQAP--PSQAAPSPTPHSQALHFQILAQILVTCLR 129
            .||..|||.||     .|:..| .|.:..|.:.|  |....|...|              ::||.
 Worm    77 AMNRHAVQHERLGAPPEPKPTQ-TLIKAKRIRKPGIPEVIDPISDP--------------ISCLS 126

  Fly   130 QA--------KANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGCGDEQLKRLICE 186
            ..        .|| .|...||   ..||...|..:|:......|  .:::::.|.:|:|:.:...
 Worm   127 AVIRWWSSLPPAN-GFPASDR---RIIFSNCWHSLFLFHVICQS--GTSLVNDCNNEKLRSISKT 185

  Fly   187 AHQLRADVLELNFMESLILCRKE----------LAINAEYAVILGSHSKAALISLARYTLQQSNY 241
            ...|..:|:|...:..:|:.|.|          |:.......||..:..|.:.        ||..
 Worm   186 IKALNLNVVEQWAITVIIIYRSEDGRLESKSETLSTQIGAMQILAENHAARVF--------QSRS 242

  Fly   242 LRFGQLLL 249
            .|..||||
 Worm   243 TRCAQLLL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 46/85 (54%)
nhr-236NP_500190.3 NR_DBD_PNR_like_1 13..88 CDD:143538 44/75 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H50838
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.