DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-226

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_503630.1 Gene:nhr-226 / 188975 WormBaseID:WBGene00020850 Length:387 Species:Caenorhabditis elegans


Alignment Length:328 Identity:67/328 - (20%)
Similarity:122/328 - (37%) Gaps:112/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNC-VVDKARRNWCPSCRFQRCLA 70
            |.:||..:.|.|:||..|..|..||:||.:  |.:    :...| ..|:.:...|..||.|:|:.
 Worm     8 CRICGKNAHGTHFGVITCRACGVFFRRSFK--SKW----IFKKCKKEDEGKICTCKPCRLQKCVE 66

  Fly    71 VGMNAAAVQEERG---PRNQQVAL-YRTGRRQ----APPSQAAPSPTPHSQALHFQILAQILVTC 127
            :||::...|.:|.   .::...:: |..||.:    ..||.:||               :||:..
 Worm    67 MGMSSKNFQYDRDAILAKHLTPSISYFVGRPEFLLFCDPSHSAP---------------KILINL 116

  Fly   128 LRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGCGDEQLKRLICEAHQLRA 192
              ....:|...||    ::.:..||::|                      .|||:|......::|
 Worm   117 --DGLVSEASRLL----RNGVESVVFAE----------------------TQLKKLALGLKVMQA 153

  Fly   193 DVLELNFMESLILCRKELAINAEY-------------------------------AVILGSHSKA 226
            |:..|.:.|.  :.:.|.....||                               .:::..|..:
 Worm   154 DMRSLKYFEK--IGKPEFLDIIEYYFTTVIKWISHFDEFRKLDQNIQMKLVQSIWHILMKFHKCS 216

  Fly   227 ALISLARYTLQQSNYLRFGQLLLGLRQLCLRR----FDCA----------LSCMF--RSVVRDIL 275
            |.::..:.:.:::.     ||...:|.:||.|    .|.:          |.|||  :|...:|:
 Worm   217 ATVAYRKSSDEKTR-----QLQKVIRNVCLDREKMKMDFSWMSDYPAHHVLRCMFSHKSYDFEII 276

  Fly   276 KTL 278
            ::|
 Worm   277 ESL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 25/84 (30%)
nhr-226NP_503630.1 ZnF_C4 7..69 CDD:197701 21/66 (32%)
Hormone_recep 157..361 CDD:278530 21/130 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.