DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-111

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_507060.2 Gene:nhr-111 / 185757 WormBaseID:WBGene00003701 Length:311 Species:Caenorhabditis elegans


Alignment Length:261 Identity:75/261 - (28%)
Similarity:116/261 - (44%) Gaps:28/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||||||.|:|.||||..|.|||.||:|:||....:.|....||||:|||.||.|.|||.::|...
 Worm    42 CAVCGDTSNGNHYGVPTCFGCSGFFRRTVRNKLVHGCWNGDGNCVIDKANRNRCKSCRIKKCFKK 106

  Fly    72 GMNAAAVQEERGPRNQQVAL-----YRTGRRQAPPSQAAPSPTPHSQALHFQILAQILV---TCL 128
            |||..|||.||...:..|..     :|...:...|:.:......|..|.|....:.:||   ..|
 Worm   107 GMNKNAVQPERTSHSYTVEYVELPSFREYSKGLLPTHSDRLRFQHEHAQHEIDTSSVLVHLKNAL 171

  Fly   129 RQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGCGDEQLKRLICEAHQLRAD 193
            :..:....||:|...::..|....|..:..|.....|..|..      ||:..:|..:...|...
 Worm   172 QWVQQFSLFAVLSDVEKSQIILTQWPHLLCLALFENSEKIFI------DEKFAQLAEKFKSLELS 230

  Fly   194 VLELNFMESLILCRK-----ELAINAEYAVILGSHSKAALISLARYTLQQSNYLRFGQLLLGLRQ 253
            ..:...::.:|:..:     :|..:.:..:.:|..::..|         :|:..:.|:||..|.:
 Worm   231 AQDYFLLKGIIIFTETKDGTDLKFDRQLDICIGLLNQLHL---------ESSKSKSGRLLFLLGE 286

  Fly   254 L 254
            |
 Worm   287 L 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 44/80 (55%)
nhr-111NP_507060.2 NR_DBD_like 42..114 CDD:143512 40/71 (56%)
Glycosyltransferase_GTB_type 115..>256 CDD:299143 25/146 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404609at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.