DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-120

DIOPT Version :10

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_509116.2 Gene:nhr-120 / 182882 WormBaseID:WBGene00003710 Length:477 Species:Caenorhabditis elegans


Alignment Length:73 Identity:32/73 - (43%)
Similarity:47/73 - (64%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |:||||:.:|.||.|..|:||..||:|::....::.| ...|||...|..|..|.:|||::|:.|
 Worm    91 CSVCGDRPTGYHYDVLSCNGCKTFFRRTIINSRNFIC-TKGGNCQFTKDFRCACRACRFEKCVRV 154

  Fly    72 GMNAAAVQ 79
            |||.:|:|
 Worm   155 GMNPSAIQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 32/73 (44%)
nhr-120NP_509116.2 NR_DBD_HNF4A 91..164 CDD:143518 32/73 (44%)
NR_LBD 267..440 CDD:132726
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.