DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-108

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_506987.1 Gene:nhr-108 / 180065 WormBaseID:WBGene00003698 Length:338 Species:Caenorhabditis elegans


Alignment Length:349 Identity:75/349 - (21%)
Similarity:108/349 - (30%) Gaps:142/349 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACI--ALVGNCVVDKARRNWCPSCRFQRCL 69
            |.|||:.|....:|...|..|:.||:|.:   .|.|.|  ...|.|.:.|..|..|.|||||:||
 Worm    10 CMVCGEISYSIRFGAVSCRACAEFFRRKI---VSKARIPKRCNGACDLGKYHRKTCQSCRFQKCL 71

  Fly    70 AVGM----NAAAVQEERGPRNQQVALYRTGRRQA------------PPSQAAPSPTPHSQ----- 113
            .:||    .|:.....|...|.|..|  :|..:|            ......|....|.:     
 Worm    72 KIGMLEKVVASRTPVNRRSENNQTIL--SGLEKAYDKLENSRDNVFDRKNKIPKYCNHQELDDMF 134

  Fly   114 -----------------------------ALHFQILAQILVTCLRQAKANEQFAL---------- 139
                                         :.||.|...:|....| |.....:.|          
 Worm   135 EIDIKLISTHFIQFFESKSSLENNQNKVLSTHFIIRFSLLEVAFR-AFGKPTYILPNNDIIDVSK 198

  Fly   140 LDRCQQ-------------DAIFQVVW--------SEIFVLRASHWSLDISAMIDGCG------- 176
            ||:..|             ..|.|..|        :|:|.:     :||.|..:..|.       
 Worm   199 LDKVYQHLETGEDERGKNSQVILQRFWQMNEKTMKTEVFPV-----NLDQSEFLFLCALIYWDFG 258

  Fly   177 -DEQLKRLICEAHQLRADVLELNFMESLILCRKELAINAEYAVILGSHSKAALISLARYTLQQSN 240
             :.|.::.:.|..::|..||            |||   .||                    ::||
 Worm   259 IENQSEKCLEECQRMRTQVL------------KEL---TEY--------------------EKSN 288

  Fly   241 Y----LRFGQLLLGLRQLCLRRFD 260
            |    ||..| ::|:.|...:..|
 Worm   289 YPENELRVAQ-VIGILQALQKTLD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 31/86 (36%)
nhr-108NP_506987.1 ZnF_C4 9..75 CDD:197701 26/67 (39%)
HOLI 134..309 CDD:214658 37/216 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.