Sequence 1: | NP_649647.1 | Gene: | Hr83 / 40783 | FlyBaseID: | FBgn0037436 | Length: | 278 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500111.3 | Gene: | nhr-92 / 176971 | WormBaseID: | WBGene00003682 | Length: | 354 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 45/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
Fly 72 GMNAAAVQEERGPRNQQVALYRTGRRQAPP----------------------------SQAAPSP 108
Fly 109 TPHSQAL-----HFQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--- 165
Fly 166 --LDISAMIDG 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hr83 | NP_649647.1 | NR_DBD_PNR_like_2 | 7..88 | CDD:143515 | 32/80 (40%) |
nhr-92 | NP_500111.3 | ZnF_C4 | 5..73 | CDD:197701 | 29/68 (43%) |
Hormone_recep | 129..330 | CDD:278530 | 13/81 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |