DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nhr-92

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_500111.3 Gene:nhr-92 / 176971 WormBaseID:WBGene00003682 Length:354 Species:Caenorhabditis elegans


Alignment Length:206 Identity:47/206 - (22%)
Similarity:83/206 - (40%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.|||..|:..|:|...|..||.||:|:|.||..|.| ..:.||::....||.|..||:.:|:.|
 Worm     5 CQVCGVPSARIHFGGVVCSACSAFFRRTVVRGHEYRC-KQMENCLIVSTIRNMCKKCRYTKCILV 68

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPP----------------------------SQAAPSP 108
            ||...:||:.|....::....:...:.|.|                            ::.||.|
 Worm    69 GMKRESVQKFRDVYGKREITVKNSTKTASPILKDFVKNYEHLENVRRVIHRDNSRSVFAKEAPRP 133

  Fly   109 TPHSQAL-----HFQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--- 165
            ..:.:|.     .|:::...:....|      :|:.|...|:..:....:.:..:|...:::   
 Worm   134 VNYKEATKVLLKEFKLVKDWINNSFR------EFSELPDDQKTTLLHNFYLQFIILEGGYFACQY 192

  Fly   166 --LDISAMIDG 174
              .||:.:..|
 Worm   193 GRTDITYLPSG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 32/80 (40%)
nhr-92NP_500111.3 ZnF_C4 5..73 CDD:197701 29/68 (43%)
Hormone_recep 129..330 CDD:278530 13/81 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.