DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Nr2f1

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_034281.2 Gene:Nr2f1 / 13865 MGIID:1352451 Length:420 Species:Mus musculus


Alignment Length:301 Identity:96/301 - (31%)
Similarity:137/301 - (45%) Gaps:62/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:|||||||...|:||..||||||||..:|.|.| ..||.:|:..||.|..||.::||.|
Mouse    83 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRA-NRNCPIDQHHRNQCQYCRLKKCLKV 146

  Fly    72 GMNAAAVQEERGPRNQ----QVAL----------YRTGRRQAPPSQAAPSPTPH--SQALH---- 116
            ||...|||..|.|..|    |.||          |.:|.... ..:|.|.||..  ||.:.    
Mouse   147 GMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISL-LLRAEPYPTSRYGSQCMQPNNI 210

  Fly   117 ------FQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--LDISAMID 173
                  .::.|::|.:.:..|:....|..|....|.::.::.|||:|||.|:..|  |.::.::.
Mouse   211 MGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLA 275

  Fly   174 GCG---------------------DEQLKRLICEAHQLRADVLELNFMESLILCRKELA--INAE 215
            ..|                     .||:::|    ..|..|..|.:.:::::|...:..  .:|.
Mouse   276 AAGLHASPMSADRVVAFMDHIRIFQEQVEKL----KALHVDSAEYSCLKAIVLFTSDACGLSDAA 336

  Fly   216 YAVILGSHSKAALISLAR--YTLQQSNYLRFGQLLLGLRQL 254
            :...|...|:.||....|  |..|.|   |||:|||.|..|
Mouse   337 HIESLQEKSQCALEEYVRSQYPNQPS---RFGKLLLRLPSL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 45/84 (54%)
Nr2f1NP_034281.2 NR_DBD_COUP_TF 83..155 CDD:143516 41/72 (57%)
NR_LBD_COUP-TF 181..416 CDD:132746 48/202 (24%)
Important for dimerization 341..420 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.