DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Nr2f6

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_034280.2 Gene:Nr2f6 / 13864 MGIID:1352453 Length:390 Species:Mus musculus


Alignment Length:342 Identity:96/342 - (28%)
Similarity:144/342 - (42%) Gaps:94/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:||||||||..|:||..|||||:||..||.|.: ..:|.:|:..||.|..||.::|..|
Mouse    57 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRS-NRDCQIDQHHRNQCQYCRLKKCFRV 120

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSP------------------------TPHS 112
            ||...|||..|.|             .|.|..||.||                        .|:.
Mouse   121 GMRKEAVQRGRIP-------------HALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEPYP 172

  Fly   113 QALHF-------------QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHW 164
            .|..|             ::.|::|.:.:..|:....|..|....|.|:.::.|||:|||.|:..
Mouse   173 AAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQA 237

  Fly   165 SLDI--SAMIDGCG---------------------DEQLKRLICEAHQLRADVLELNFMESLILC 206
            :|.:  :.::...|                     .||:.:|    .:|:.|..|...::::.|.
Mouse   238 ALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKL----GRLQVDAAEYGCLKAIALF 298

  Fly   207 RKELAINAEYAVILGSHSKAALISLARYTLQQ--SNYLRFGQLLLGLRQLCLRRFDCAL-SCMF- 267
            ..:....::.|.:.....||. ::|..|...|  |...|||:||  ||...||....:| |.:| 
Mouse   299 TPDACGLSDPAHVESLQEKAQ-VALTEYVRAQYPSQPQRFGRLL--LRLPALRAVPASLISQLFF 360

  Fly   268 ---------RSVVRDIL 275
                     .:::||:|
Mouse   361 MRLVGKTPIETLIRDML 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/80 (53%)
Nr2f6NP_034280.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
NR_DBD_COUP_TF 57..129 CDD:143516 39/72 (54%)
NR_LBD_COUP-TF 157..387 CDD:132746 48/228 (21%)
Important for dimerization. /evidence=ECO:0000250 314..390 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.