DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and nr2e1

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002937209.2 Gene:nr2e1 / 100491500 XenbaseID:XB-GENE-483554 Length:386 Species:Xenopus tropicalis


Alignment Length:344 Identity:110/344 - (31%)
Similarity:151/344 - (43%) Gaps:104/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYAC-IALVGNCVVDKARRNWCPSCRFQRCLA 70
            |.||||:||||||||..|||||.|||||:||..||.| ....|.|:|||..||.|.:||.::||.
 Frog    16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGGCLVDKTHRNQCRACRLKKCLE 80

  Fly    71 VGMNAAAVQEERGPR----NQQVALYRTGRRQ----AP--PSQAAPSPT---------PHSQAL- 115
            |.||..|||.|||||    .:|||||..|.::    .|  ||.|.|:||         ||:..| 
 Frog    81 VNMNKDAVQHERGPRTSTIRKQVALYFRGHKEINGSTPHFPSAALPAPTFFTTVSQLEPHNLELT 145

  Fly   116 ----------------------H---------FQI--------LAQILVTCLRQAKANEQFALLD 141
                                  |         :::        .|::|...::.||:...|:.|.
 Frog   146 AISTTPERQTLVGLAQPTPKYPHEVNGAPLYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLS 210

  Fly   142 RCQQDAIFQVVWSEIFVLRASHWSLDISAMI---------DGCGDEQLKRLICEA---------- 187
            ...|..:.:..|.|:|||..:.|::.:.|..         |....::|.::|.|.          
 Frog   211 LQDQLMLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRF 275

  Fly   188 HQLRADVLELNFMESLILCR--------KELAINAEYAVILGSHSKAALISLARYTLQQSNYL-- 242
            .|||.|..|...::.::..:        .||......|.|      |||...|:.||  ::|:  
 Frog   276 RQLRLDATEFACLKCIVTFKAGVPPHSGSELRSFRNAAAI------AALQDEAQLTL--NSYIHT 332

  Fly   243 -------RFGQLLLGLRQL 254
                   |||:|||.|..|
 Frog   333 RYPTQPCRFGKLLLLLPAL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 51/85 (60%)
nr2e1XP_002937209.2 NR_DBD_TLX 8..99 CDD:143537 51/82 (62%)
NR_LBD_Tlx_PNR_like 154..370 CDD:132748 43/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.