DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Nr2e3

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_038938356.1 Gene:Nr2e3 / 100365683 RGDID:2318602 Length:395 Species:Rattus norvegicus


Alignment Length:361 Identity:106/361 - (29%)
Similarity:138/361 - (38%) Gaps:116/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||.|||||||:..|:|||.||||||||...|.|....|.|.||||.||.|.:||.::||..
  Rat    40 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQA 104

  Fly    72 GMNAAAVQEERGPRN-QQVALYRTGRRQAPPSQAAPSPTPHSQAL-------------------H 116
            |||..|||.||.||: .||.|    ....|.|...|.|...|.||                   |
  Rat   105 GMNQDAVQNERQPRSLAQVHL----ESMEPGSDPRPEPVVASPALAGPSPRGPTSVSAARAMGHH 165

  Fly   117 F------------------------------------------QILAQILVTCLRQAKANEQFAL 139
            |                                          :..|::|...::.||....|:.
  Rat   166 FMASLISAETCAKLEPEDAEENIDVTSNDPEFPASPCNLDGIHETSARLLFMAVKWAKNLPVFSN 230

  Fly   140 LDRCQQDAIFQVVWSEIFVLRASHWSLDISAMIDGC---------GDEQ------------LKRL 183
            |....|..:.:..|:|:|:|.|..|||.    :|.|         ...|            |:..
  Rat   231 LPFRDQVILLEEAWNELFLLGAIQWSLP----LDSCPLLAPPEASSSSQGRLALASAEMRFLQET 291

  Fly   184 ICEAHQLRADVLELNFMESLILCRKEL----------AINAEYAVILGSHSKAALISLARYTLQQ 238
            |.....|..|..|...:::|:|.:.|.          |:..:..|:|..||||.         ..
  Rat   292 ISRFRALAVDPTEFACLKALVLFKPETRGLKDPDHVEALQDQSQVMLSQHSKAH---------HP 347

  Fly   239 SNYLRFGQLLL---GLRQLCLRRFDCALSCMFRSVV 271
            |..:|||:|||   .||.:...|.:.   ..||..:
  Rat   348 SQPVRFGKLLLLLPSLRFITAERIEL---LFFRKTI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 49/81 (60%)
Nr2e3XP_038938356.1 NR_DBD_PNR 32..123 CDD:143528 49/82 (60%)
NR_LBD_Tlx_PNR_like 185..382 CDD:132748 45/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.