DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf3 and meu34

DIOPT Version :9

Sequence 1:NP_001074393.1 Gene:Znrf3 / 407821 MGIID:3039616 Length:913 Species:Mus musculus
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:38/162 - (23%)
Similarity:54/162 - (33%) Gaps:61/162 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse   232 ILLVKIKLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDT--------------- 281
            :|...|..::|||..|...|:..:|| :...|:..|.||..:|....||.               
pombe    89 VLGYDIPSRRRRSVVSKEALSCISLE-IPYIKWLKKRKGHAKGESTFLDNRSENQSVIVQGQGET 152

Mouse   282 ---------------------------------LSSGSTSD-----------CAICLEKYIDGEE 302
                                             .|.|.:||           |.||...|...:.
pombe   153 PSVIITYDVRRPNLGSTSFVEMSSALSNIYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDI 217

Mouse   303 LRVIPCTHRFHRKCVDPWL-LQHHTCPHCRHN 333
            |||:||.|.||.:|:|.|: ....:||.|..:
pombe   218 LRVLPCEHVFHTQCIDTWMTTMKASCPLCNED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf3NP_001074393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-RING_2 289..331 CDD:290367 18/53 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..913
meu34NP_593329.1 RING 205..249 CDD:238093 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3398
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm59359
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.