DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and SMD2

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_013377.1 Gene:SMD2 / 850981 SGDID:S000004265 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:60/109 - (55%)
Similarity:79/109 - (72%) Gaps:7/109 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV 69
            :||.||:..||...||.||..||:|::..::...|.|:|:.|||.|::.||||||||||||||||
Yeast     8 RPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENV 72

  Fly    70 KEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPL 113
            ||:|||       ||....:|::|||||:||||||||:||:.|:
Yeast    73 KELWTE-------KKGKNVINRERFISKLFLRGDSVIVVLKTPV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 50/88 (57%)
SMD2NP_013377.1 Sm_D2 27..108 CDD:212467 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346024
Domainoid 1 1.000 92 1.000 Domainoid score I1722
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3381
Inparanoid 1 1.050 122 1.000 Inparanoid score I1297
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53765
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - oto99968
orthoMCL 1 0.900 - - OOG6_102323
Panther 1 1.100 - - LDO PTHR12777
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1358
SonicParanoid 1 1.000 - - X3049
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.