DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and AT3G62840

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_567134.3 Gene:AT3G62840 / 825459 AraportID:AT3G62840 Length:109 Species:Arabidopsis thaliana


Alignment Length:108 Identity:87/108 - (80%)
Similarity:96/108 - (88%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV 69
            ||..|.|.:  .:.|||||||||||||..|||||||||||||||:||||||:|||||||||||||
plant     3 KPMEEDTNQ--GKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENV 65

  Fly    70 KEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNP 112
            :|||||:|:|||||||..|||:|||||||||||||||:|||||
plant    66 REMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 77/88 (88%)
AT3G62840NP_567134.3 Sm_D2 19..108 CDD:212467 77/88 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1545
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3381
Inparanoid 1 1.050 178 1.000 Inparanoid score I1467
OMA 1 1.010 - - QHG53765
OrthoDB 1 1.010 - - D1581611at2759
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - oto3671
orthoMCL 1 0.900 - - OOG6_102323
Panther 1 1.100 - - LDO PTHR12777
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3049
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.