DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and lsm6

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001165068.1 Gene:lsm6 / 779701 XenbaseID:XB-GENE-1007008 Length:80 Species:Xenopus tropicalis


Alignment Length:82 Identity:17/82 - (20%)
Similarity:31/82 - (37%) Gaps:16/82 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTELPRTGKGKKKVKPVNK 91
            |...|.|.:  ...|::...:.....|.:...|.:.|:.||..:|.     ..|:.|.|      
 Frog     8 PSDFLKQII--GRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEY-----VNGQLKNK------ 59

  Fly    92 DRFISKMFLRGDSVILV 108
               ....|:||::|:.:
 Frog    60 ---YGDAFIRGNNVLYI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 17/82 (21%)
lsm6NP_001165068.1 LSm6 7..74 CDD:212473 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.