DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and snrpd2

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001017582.1 Gene:snrpd2 / 550244 ZFINID:ZDB-GENE-040914-10 Length:118 Species:Danio rerio


Alignment Length:117 Identity:103/117 - (88%)
Similarity:111/117 - (94%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 67
            |.|||||:|||||.::|||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     4 LNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 68

  Fly    68 NVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK 119
            ||||||||:|::||||||.|||||||:||||||||||||:||||||.|  ||
Zfish    69 NVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIT--GK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 82/88 (93%)
snrpd2NP_001017582.1 Sm_D2 24..113 CDD:212467 82/88 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594632
Domainoid 1 1.000 144 1.000 Domainoid score I4570
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3381
Inparanoid 1 1.050 210 1.000 Inparanoid score I3651
OMA 1 1.010 - - QHG53765
OrthoDB 1 1.010 - - D1581611at2759
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - oto41209
orthoMCL 1 0.900 - - OOG6_102323
Panther 1 1.100 - - LDO PTHR12777
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1358
SonicParanoid 1 1.000 - - X3049
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.