DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and snrpd2

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001005128.1 Gene:snrpd2 / 448710 XenbaseID:XB-GENE-964248 Length:118 Species:Xenopus tropicalis


Alignment Length:117 Identity:103/117 - (88%)
Similarity:111/117 - (94%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 67
            |.|||||:|||||.::|||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     4 LNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 68

  Fly    68 NVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK 119
            ||||||||:|::||||||.|||||||:||||||||||||:||||||  .|||
 Frog    69 NVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPL--LAGK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 82/88 (93%)
snrpd2NP_001005128.1 Sm_D2 24..113 CDD:212467 82/88 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4581
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3381
Inparanoid 1 1.050 208 1.000 Inparanoid score I3596
OMA 1 1.010 - - QHG53765
OrthoDB 1 1.010 - - D1581611at2759
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - oto104591
Panther 1 1.100 - - LDO PTHR12777
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3049
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.