DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and LSm3

DIOPT Version :10

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_732931.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster


Alignment Length:82 Identity:31/82 - (37%)
Similarity:49/82 - (59%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTELPRTGKGKKKVKPVNK 91
            ||.::..|:  :.:|.:..||.::|.||:.|||:|.||||.:.:|..|.:....:..::|....|
  Fly    18 PLDLIRLSL--DEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTVEIDEETYEEVYKTAK 80

  Fly    92 DRFISKMFLRGDSVILV 108
             |.|..:|:|||.||||
  Fly    81 -RTIPMLFVRGDGVILV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 31/82 (38%)
LSm3NP_732931.1 LSm3 17..98 CDD:212477 31/82 (38%)

Return to query results.
Submit another query.