DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and Snrpd2l

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_214847.2 Gene:Snrpd2l / 292688 RGDID:1305065 Length:118 Species:Rattus norvegicus


Alignment Length:117 Identity:100/117 - (85%)
Similarity:111/117 - (94%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 67
            |.|||||:|||||.::||||||||||||||||:||||||||||||||||||||||||||||||||
  Rat     4 LNKPKSEMTPEELQKREEEEFNTGPLSVLTQSIKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE 68

  Fly    68 NVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK 119
            ||||:|||:|::||||||.|||||||:||||||||:|||:||||||  .|||
  Rat    69 NVKEIWTEVPKSGKGKKKSKPVNKDRYISKMFLRGNSVIVVLRNPL--IAGK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 79/88 (90%)
Snrpd2lXP_214847.2 Sm_D2 24..113 CDD:212467 79/88 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352689
Domainoid 1 1.000 144 1.000 Domainoid score I4485
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3611
OMA 1 1.010 - - QHG53765
OrthoDB 1 1.010 - - D1581611at2759
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - otm45913
orthoMCL 1 0.900 - - OOG6_102323
Panther 1 1.100 - - O PTHR12777
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3049
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.