DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD2 and smd2

DIOPT Version :9

Sequence 1:NP_649645.1 Gene:SmD2 / 40781 FlyBaseID:FBgn0261789 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_594506.1 Gene:smd2 / 2542480 PomBaseID:SPAC2C4.03c Length:115 Species:Schizosaccharomyces pombe


Alignment Length:110 Identity:83/110 - (75%)
Similarity:91/110 - (82%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV 69
            ||:|||:..||||.||.||:.||||||.|:|||:.|||||||||||||.||||||||.|||||||
pombe     7 KPRSELSEIELARLEEYEFSAGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENV 71

  Fly    70 KEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLA 114
            ||||||..||..|||. |.:||||||||||||||.|:||:|.|.|
pombe    72 KEMWTEKKRTASGKKG-KAINKDRFISKMFLRGDGVVLVVRIPSA 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD2NP_649645.1 Sm_D2 23..112 CDD:212467 69/88 (78%)
smd2NP_594506.1 Sm_D2 25..113 CDD:212467 69/88 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1491
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3381
Inparanoid 1 1.050 160 1.000 Inparanoid score I1248
OMA 1 1.010 - - QHG53765
OrthoFinder 1 1.000 - - FOG0004313
OrthoInspector 1 1.000 - - oto101683
orthoMCL 1 0.900 - - OOG6_102323
Panther 1 1.100 - - LDO PTHR12777
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1358
SonicParanoid 1 1.000 - - X3049
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.