DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and FT

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT / 842859 AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana


Alignment Length:164 Identity:61/164 - (37%)
Similarity:89/164 - (54%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QVVPDVIPEPPNQ--LLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQP-GEFYTLIMTDPDAP 89
            :||.||: :|.|:  .|||||....|. :|::|.|:||:::|.||...:. ..||||:|.|||.|
plant    57 RVVGDVL-DPFNRSITLKVTYGQREVT-NGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVP 119

  Fly    90 SRAEPKFREFKHWILANI-AGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERV 153
            |.:.|..||:.||::.:| |......|..|..|  ..|....|:||.||:|::|.|       |.
plant   120 SPSNPHLREYLHWLVTDIPATTGTTFGNEIVCY--ENPSPTAGIHRVVFILFRQLG-------RQ 175

  Fly   154 SKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            :..:...|..|:..:||..:.||.|:|..||..|
plant   176 TVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 54/146 (37%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.