DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and TFL1

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:190 Identity:62/190 - (32%)
Similarity:95/190 - (50%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLLPLVGCLLAVQAGSVEEVFRSHQVVPDVIP-EPPNQLLKVTYSNNLVAKDGVELTPTQVKDQ 66
            ||:.||:                ..:||.||:. ..|...:.|:|:...|: :|.||.|:.|..:
plant     7 RVIEPLI----------------MGRVVGDVLDFFTPTTKMNVSYNKKQVS-NGHELFPSSVSSK 54

  Fly    67 PVVEWDAQPGE---FYTLIMTDPDAPSRAEPKFREFKHWILANIAG-NDLASGEPIAEYIGSGPP 127
            |.||  ...|:   |:||:|.|||.|..::|..:|..|||:.||.| .|...|:.:..|  ..|.
plant    55 PRVE--IHGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPR 115

  Fly   128 QGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            ...|:||:||:|::|.      :.||...:...|..|:..|||:.::||.|:|..|:.||
plant   116 PSIGIHRFVFVLFRQK------QRRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 51/148 (34%)
TFL1NP_196004.1 PEBP 4..177 CDD:412238 62/190 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.