DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and TSF

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_193770.1 Gene:TSF / 827785 AraportID:AT4G20370 Length:175 Species:Arabidopsis thaliana


Alignment Length:168 Identity:60/168 - (35%)
Similarity:95/168 - (56%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VVPDVIPEPPNQL--LKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQP-GEFYTLIMTDPDAPS 90
            ||.||: :|..:|  |||||.:..|. :|::|.|:||.::|:||..... ..||||:|.|||.||
plant    14 VVGDVL-DPFTRLVSLKVTYGHREVT-NGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPS 76

  Fly    91 RAEPKFREFKHWILANI---AGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEER 152
            .:.|..||:.||::.:|   .||  |.|..:..|....||  :|:||.|.:|::|.|       |
plant    77 PSNPHQREYLHWLVTDIPATTGN--AFGNEVVCYESPRPP--SGIHRIVLVLFRQLG-------R 130

  Fly   153 VSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDD 190
            .:..:...|.:|:..:||..:.||.|:|.:::..|.::
plant   131 QTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQREN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 54/150 (36%)
TSFNP_193770.1 PLN00169 1..175 CDD:177765 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.