DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Pebp4

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:129 Identity:44/129 - (34%)
Similarity:71/129 - (55%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PVVEW-DAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLAS----GEPIAEYIGSGP 126
            |:|:: .|..|..|.|:|.|||||||:.|..:.::||:::||.|.|:.|    |..:::|....|
Mouse    99 PIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNVLSDYSPPTP 163

  Fly   127 PQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDD 190
            |..||||||.|.:|.|..:    :..:|...:.|...::..||...:.|.:|...|.:..|:|:
Mouse   164 PPETGLHRYQFFVYLQGDR----DISLSVEEKADLGGWNLDKFLQQYGLRDPDTSTQFMTQFDE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 42/123 (34%)
Pebp4NP_082836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..50
PEBP_euk 95..219 CDD:176644 42/123 (34%)
Important for secretion. /evidence=ECO:0000250|UniProtKB:Q96S96 210..242 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.