DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Pebp4

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_008769058.2 Gene:Pebp4 / 691997 RGDID:1593295 Length:235 Species:Rattus norvegicus


Alignment Length:132 Identity:45/132 - (34%)
Similarity:72/132 - (54%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PVVEW-DAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLAS----GEPIAEYIGSGP 126
            |:|:: .|..|..|.|:|.|||||||:.|:.:.::||:::||.|.|:.|    |..|.:|....|
  Rat    92 PIVKFHGALDGAQYLLVMVDPDAPSRSNPRMKYWRHWVVSNITGTDMKSGSIRGNIITDYQPPTP 156

  Fly   127 PQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDY 191
            |..||||||.|.:|.|..:    :..:.:...::|..:...||...:.|.:|...|.:..|:|..
  Rat   157 PPTTGLHRYQFFVYLQGDR----DISIPESENENRGAWKLDKFLQQYGLQDPDTSTQFMTQFDGE 217

  Fly   192 VP 193
            :|
  Rat   218 LP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 42/123 (34%)
Pebp4XP_008769058.2 PEBP_euk 60..212 CDD:176644 42/123 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.