DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Mrpl38

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_077139.2 Gene:Mrpl38 / 60441 MGIID:1926269 Length:380 Species:Mus musculus


Alignment Length:196 Identity:58/196 - (29%)
Similarity:87/196 - (44%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGE 77
            ||...|...::|.....||.|   |.:....|...:.:....|.|:|||:....|.|.::|....
Mouse   151 LAEYYGLYRDLFHGATFVPWV---PLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEVTYEADKDS 212

  Fly    78 FYTLI-------MTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRY 135
            .:||:       :.:|||         |:.||:|.||..|.:|.|:....|:...|.:|:|.||:
Mouse   213 LWTLLFINLDGHLLEPDA---------EYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRF 268

  Fly   136 VFLLYKQSGKLEFDEE-RVSKRSRKDRPKFSAAKFAINH-ELGNPIAGTFYQAQYDDYVPKLHKQ 198
            .|||:||...:.|.|: |.|...:..:..|....|...| |...|....|:|.::||.|.....|
Mouse   269 AFLLFKQDKPINFSEDTRPSPCYQLAQRTFRTFDFYKRHQEAMTPAGLAFFQCRWDDSVTHTFHQ 333

  Fly   199 L 199
            |
Mouse   334 L 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 44/153 (29%)
Mrpl38NP_077139.2 PEBP_euk 171..321 CDD:176644 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.