DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and pebp1.2

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001016825.1 Gene:pebp1.2 / 549579 XenbaseID:XB-GENE-973798 Length:186 Species:Xenopus tropicalis


Alignment Length:169 Identity:82/169 - (48%)
Similarity:120/169 - (71%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|.|.|.|.|||.:..:.:.|..||||||:.:| .:||:. ...:.|||::||||||||..|||
 Frog    17 VEEKPAQPLLVTYGSLGIDELGQVLTPTQVQSRPSSIEWEGMDSSKLYTLVLTDPDAPSRKNPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.||::.||..:::|:|||||:||||||||:|:|:|:.:|:..|..:..||.:.|
 Frog    82 REWHHFLVVNMKGNNINSGCVLSDYVGSGPPKGTGLHRYVWLVYEQTEELKCTERVLCNRSGEHR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            ..|..|.|...::||.|:||..|||::|||||||::|||
 Frog   147 GMFKVASFRQKYKLGTPVAGNCYQAEWDDYVPKLYEQLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 67/146 (46%)
pebp1.2NP_001016825.1 PEBP_euk 24..171 CDD:176644 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5435
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3897
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm47464
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.