DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and PEBP1

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_002558.1 Gene:PEBP1 / 5037 HGNCID:8630 Length:187 Species:Homo sapiens


Alignment Length:169 Identity:88/169 - (52%)
Similarity:122/169 - (72%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPV-VEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|.|...|.|||:...|.:.|..|||||||::|. :.||. ..|:.|||::||||||||.:||:
Human    17 VDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKY 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..:::|:|||||:||||||||:|:|:|...|:.||..:|.||...|
Human    82 REWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||..|.|...:||..|:|||.|||::|||||||::|||
Human   147 GKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 74/146 (51%)
PEBP1NP_002558.1 PEBP_euk 23..171 CDD:176644 74/147 (50%)
Interaction with RAF1. /evidence=ECO:0000269|PubMed:18294816 93..134 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149346
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3692
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm40286
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.