DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Pebp1

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster


Alignment Length:167 Identity:86/167 - (51%)
Similarity:115/167 - (68%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDAPSRAE 93
            ::||:|...|.....:||.:.:..:.|.|||||||||||.|.:||:|...||:::.|||||||.:
  Fly     6 IIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDAPSRED 70

  Fly    94 PKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSR 158
            |||||..||::.||.||.::.|:.||||||:||.:||||||||||::||:.|:. .|:.|||.||
  Fly    71 PKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKIT-TEKFVSKTSR 134

  Fly   159 KDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKL 195
            ..|....|..:...:..|.|:||.|:||||||||..|
  Fly   135 TGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 73/144 (51%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 73/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452390
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.