DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and CG10298

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster


Alignment Length:177 Identity:102/177 - (57%)
Similarity:130/177 - (73%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDA 88
            |..|::|||::...|..||.|||....|...|.|||||||:.||.|:|||.|..||||::|||||
  Fly     8 FSKHKIVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDA 72

  Fly    89 PSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERV 153
            |||.||||||:.||::.||.||.:.:|..:.||:|:||||||||||||||::||..||..:|.::
  Fly    73 PSRKEPKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKI 137

  Fly   154 SKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .|.|...|..||.:||...::||:||||.|:|||:|||||||:||||
  Fly   138 PKTSGDKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 82/144 (57%)
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 82/145 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469059
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm25702
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
1211.830

Return to query results.
Submit another query.