DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and mrpl35

DIOPT Version :10

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:mrpl35 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:31/130 - (23%)
Similarity:56/130 - (43%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPI---AEYIGSGPP---QGTGLHRYVF 137
            |::|..|.|.|:....:|....:|:|.||. .:.:...||   ..:....||   :|...||.:.
pombe   173 YSVITLDLDVPNYETNRFETHCNWLLTNIP-IEASKRVPIDTSKAFFQYRPPIVHRGEDKHRILT 236

  Fly   138 LLYKQ-SGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYD-DYVPKLHKQLS 200
            |:.:| |..:......:.      |.:|..::|...::| .|:....:::.:| |.|..|.|..|
pombe   237 LVLRQKSSSISIPSNALV------RERFDLSEFCSIYDL-EPVGAHLWRSGWDSDAVALLSKHPS 294

  Fly   201  200
            pombe   295  294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 25/113 (22%)
mrpl35NP_001342831.1 PEBP_euk 130..279 CDD:176644 25/113 (22%)

Return to query results.
Submit another query.