DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Pbp2

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001099226.1 Gene:Pbp2 / 246145 RGDID:621707 Length:187 Species:Rattus norvegicus


Alignment Length:169 Identity:91/169 - (53%)
Similarity:126/169 - (74%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|.|..||:|||:...|::.|..|||||||::| .:.||. .||:.||||:||||||||.||.:
  Rat    17 VDEQPQHLLRVTYAGAEVSELGQVLTPTQVKNRPSSITWDGLDPGKLYTLILTDPDAPSRKEPIY 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||:.:::|:|||||:||||||||:|:|:|...|:.||..::.||...|
  Rat    82 REWHHFLVVNMKGNDISSGKVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLKCDEPILTNRSGNQR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||.||.|...:.||.|:|||.|||::|.|||||:||||
  Rat   147 GKFKAAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 77/146 (53%)
Pbp2NP_001099226.1 PEBP_euk 23..171 CDD:176644 77/147 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H135930
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm8913
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.