DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Pebp1

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_061346.2 Gene:Pebp1 / 23980 MGIID:1344408 Length:187 Species:Mus musculus


Alignment Length:169 Identity:87/169 - (51%)
Similarity:121/169 - (71%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|||...|:|.|:...|.:.|..||||||.::| .:.||. .||:.|||::||||||||.:|||
Mouse    17 VDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..:::|:|||||.||||||||:|:|:|...|..||..:|.:|..:|
Mouse    82 REWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||....|...:.||.|:|||.|||::|||||||::|||
Mouse   147 GKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 72/146 (49%)
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 72/145 (50%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm8678
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.