DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and Y69E1A.5

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 / 190551 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans


Alignment Length:183 Identity:55/183 - (30%)
Similarity:89/183 - (48%) Gaps:28/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTP------TQVKDQPVVEW---DAQP 75
            :...|..|::.|.:|...|.|.|.:.:       ||:::.|      ..:|:.|  .|   .|.|
 Worm     4 ISAAFAQHEITPKIIENAPKQKLHLCW-------DGIQVEPGMTMQVRNLKNAP--RWALPGADP 59

  Fly    76 GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLA----SGEPIAEYIGSGPPQGTGLHRYV 136
            ...||::|.|||..||..|...|:.||::.||..:::.    .|:....|....|...|.|||||
 Worm    60 ESIYTVLMIDPDNLSRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYV 124

  Fly   137 FLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYD 189
            .|:::.:|:      |:|......|.||:..:|...::||:||||.|:.||::
 Worm   125 ILMWEHAGR------RISVPKPSSRAKFNVKQFIEKNKLGDPIAGNFFLAQHE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 47/157 (30%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.