DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and C56G2.4

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_498385.2 Gene:C56G2.4 / 175894 WormBaseID:WBGene00016979 Length:538 Species:Caenorhabditis elegans


Alignment Length:189 Identity:44/189 - (23%)
Similarity:70/189 - (37%) Gaps:66/189 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YSNNLVA------KDGVELTPTQVKDQPVVEWDA-QPGEFYTLIMTD----------PDAPSRAE 93
            :|.|..|      .|.||  |.:::.:|.:.|.. |..|.||:::||          .|.|.   
 Worm   112 FSGNTSAVQADPDMDPVE--PFRIRKRPEITWSGLQYDEQYTVVITDVGYATINFLAVDFPK--- 171

  Fly    94 PKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSR 158
                          |...|...||...|..|..|.       |.|::: :|:.:.:    |.:|.
 Worm   172 --------------ATKILKDYEPTENYRPSPNPM-------VVLVFR-NGRADIE----SPKSE 210

  Fly   159 KDRPKFSAAKFAINHELGNPIAG-TFYQAQYD-------------DYVPK-LHKQLSEN 202
            :|   |:..:|.:.|||.:.:.| :...|..|             ||... |.|:|:.|
 Worm   211 ED---FNLPQFMLKHELEDDLVGLSLIVASSDPFAIEKQRLRGKVDYCHSLLQKRLASN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 36/157 (23%)
C56G2.4NP_498385.2 PEBP <374..454 CDD:294157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.