DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10298 and Pebp4

DIOPT Version :10

Sequence 1:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:140 Identity:50/140 - (35%)
Similarity:66/140 - (47%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PKVKW-DADPNAFYTLLLTDPDAPSRKEPKFREWHHWLVVNIPGNQVENGV----VLTEYVGAGP 110
            |.||: .|...|.|.|::.|||||||..|..:.|.||||.||.|..:::|.    ||::|....|
Mouse    99 PIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNVLSDYSPPTP 163

  Fly   111 PQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSGDKRANFST-----------SKFMSKYKLGDPIA 164
            |..||||||.|.|:.|               ||:..:.|.           .||:.:|.|.||..
Mouse   164 PPETGLHRYQFFVYLQ---------------GDRDISLSVEEKADLGGWNLDKFLQQYGLRDPDT 213

  Fly   165 GNFFQAQWDD 174
            ...|..|:|:
Mouse   214 STQFMTQFDE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 48/134 (36%)
Pebp4NP_082836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..50
PEBP_euk 95..219 CDD:176644 48/134 (36%)
Important for secretion. /evidence=ECO:0000250|UniProtKB:Q96S96 210..242 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.