DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10298 and CG7054

DIOPT Version :10

Sequence 1:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:88/178 - (49%)
Similarity:115/178 - (64%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDA--DPNAFYTLLLTDPDAPSR 75
            ||||:|...||..:.|.||....|..|.|||||||:.||.|.|..  ..:...|||:.|||||:|
  Fly     4 IVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPTR 68

  Fly    76 KEPKFREWHHWLVVNIPGNQVEN---GVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKI 137
            ::||:||..||.||||||:. ||   |..|.:|||:|||:.||||||:||:::|..|:. ..|.|
  Fly    69 QDPKYREILHWSVVNIPGSN-ENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENKIE-ETPTI 131

  Fly   138 PKTSGDKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLSG 185
            ..|:...|.||:...|.:|:.||:|||.|::|||:|||||...|.:.|
  Fly   132 SNTTRTGRLNFNARDFAAKHGLGEPIAANYYQAQYDDYVPIRNKTIVG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 71/150 (47%)
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 71/150 (47%)

Return to query results.
Submit another query.