DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10298 and mrpl35

DIOPT Version :10

Sequence 1:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:mrpl35 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:36/131 - (27%)
Similarity:60/131 - (45%) Gaps:18/131 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YTLLLTDPDAPSRKEPKFREWHHWLVVNIPGN-----QVENGVVLTEYVGAGPP---QGTGLHRY 119
            |:::..|.|.|:.:..:|....:||:.|||..     .::......:|   .||   :|...||.
pombe   173 YSVITLDLDVPNYETNRFETHCNWLLTNIPIEASKRVPIDTSKAFFQY---RPPIVHRGEDKHRI 234

  Fly   120 VFLVFKQPQKLTCNEPKIPKTSGDKRANFSTSKFMSKYKLGDPIAGNFFQAQWD-DYVPKLYKQL 183
            :.||.:|..    :...|| ::...|..|..|:|.|.|.| :|:..:.:::.|| |.|..|.|..
pombe   235 LTLVLRQKS----SSISIP-SNALVRERFDLSEFCSIYDL-EPVGAHLWRSGWDSDAVALLSKHP 293

  Fly   184 S 184
            |
pombe   294 S 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 29/114 (25%)
mrpl35NP_001342831.1 PEBP_euk 130..279 CDD:176644 29/114 (25%)

Return to query results.
Submit another query.